PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00136942001
Common NameGSBRNA2T00136942001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 1022aa    MW: 111694 Da    PI: 9.2177
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00136942001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.11.7e-27149202256
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          ++++WtpeLH+rFv+aveqL G ekA+P++ilelm+v++Lt+++v+SHLQkYR++
  GSBRNA2T00136942001 149 KKVDWTPELHRRFVDAVEQL-GLEKAVPSRILELMGVHCLTRHNVASHLQKYRSH 202
                          5899****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.728145204IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-26146205IPR009057Homeodomain-like
SuperFamilySSF466897.17E-17149205IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-25149202IPR006447Myb domain, plants
PfamPF002494.1E-7151200IPR001005SANT/Myb domain
PfamPF141116.1E-31651793IPR025558Domain of unknown function DUF4283
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1022 aa     Download sequence    Send to blast
MLALSPARNS ARGGCFDGES EFLATSSDFT INPEENFPVF TDQGDLLDII DFDDLFGVAG  60
DVLPDLEIDP EILAGDFSAS SSSEKTDSQG ETNKKGISEE VVSKRDEDET AMSEKMANYV  120
DGDSNRKRKY SSSSGSSKNN SNEGKRKVKK VDWTPELHRR FVDAVEQLGL EKAVPSRILE  180
LMGVHCLTRH NVASHLQKYR SHRKHVLARE AEAANWTRKR HIYGLDSTGV NINGRNKNGW  240
IAPAPTIGYA PPPPAAVASP TIHHHHFRPL HVWGHPTVNQ SVIPHVFPKH LPPPSTAMAT  300
TPFWVSDNPY WPRVHNGTAP YFPTVATRFR APPVAGIPQA MPPHHTVYKP DHGYGGSRSL  360
VDLHPSKESV DAAIGDVLTR PWLPLPLGLK PPAFDGVMTE LHRHGVSEST INPRGRKHLQ  420
RIFLSLPKAK LRSLSFALIR RRCRRRSPPP PYMAKKKKPK PVSSGASPVA SIDSSVPSAS  480
SSATVPVSPD PAAASSPALE EGEISPFSAS FHHLATAENF QDQNSSPIAD LQEKGLEVLE  540
NPNAQTAATE PTVPVNPITE AAATESHVPV STHPEKPLQS DKLQSPPVAP IASNQASESS  600
QLQAQPTTVF KDQAKQWVDK VKTKARKLDP EGTPFTLESG EACVKIPNSV IEKNRKSWDS  660
FIIGQFYEEA PARAKIHAIV NGMWSKHRRD IAVSKMNGNA FLFRVPCPNA RRCILSQCLW  720
QVDGQTLFVA KWSPGLKPEK PSLATVPVWL DFTGVPLQFF NEDALKEIAV LVGHPLCLHP  780
TTSNLTNIEV ARVYTVIDLR KPLPEAVNAQ FETGEITRTT VSSPWLPSLC SHCKKVGHTI  840
SRFSLAPPTC ATCRSVKHNT DACPRNSNHH RQGKEPIASQ YPIVPNPAAS RYKNNPGPRA  900
TGPAPSSHSK KGNSIWIRAD PSALEDNGKR QASRSIPLLP AGVPRHDEGL KDFCVDLRSN  960
LFTSGSKAPS TASSTSQSDS EDLSYDDDNP DIEGDKYIEV ISKRKKKLSR ALARARGPLN  1020
L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-14146206363ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1439457RRRCRRRSPPPPYMAKKKK
2443457RRRSPPPPYMAKKKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.83380.0leaf| seed| vegetative meristem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00136942001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3525260.0AK352526.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-01-C06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A078D3V40.0A0A078D3V4_BRANA; BnaC08g36330D protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22092773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.11e-162GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]